Anti-TP53 antibody produced in rabbit

Product Name: Anti-TP53 antibody produced in rabbit

Synonym: Anti-Tumor protein p53 (Li-Fraumeni syndrome)

Product Type: Chemical

CAS NO: ATM_ATR inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 44 kDa
NCBI accession no.
NP_000537
Shipped in: wet ice
species reactivity
horse, human, rat
Storage temp.: −20°C
Application: Anti-TP53 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
TP53 is a tumor suppressor protein essential for protection against development of cancer. Mutations in the TP53 gene or alterations in function of the protein result in predisposition to colorectal cancer, gastric and esophageal cancers. TP53 also acts as a transcription factor and maintains the genetic stability preventing malignant transFormation.
Immunogen:
The immunogen for anti-TP53 antibody: synthetic peptide derected towards the C terminal of human TP53
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: RELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/789