Product Name: Anti-TUBA3C antibody produced in rabbit

Synonym: Anti-TUBA2; Anti-Tubulin, α3c; Anti-bA408E5.3

Product Type: Chemical

CAS NO: 254964-60-8Parasite inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 50 kDa
NCBI accession no.
NP_525125
Shipped in: wet ice
species reactivity
, human, mouse, rat, rabbit, Caenorhabditis elegans
Storage temp.: −20°C
Application: Anti-TUBA3C antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions:
Tubulin α-3C/D chain is a protein encoded by the TUBA3C gene in humans. TUBA3C (tubulin, α3c) gene encodes a major cytoskeleton protein that belongs to tubulin family and is localized on to 13q11 region. It encodes microtubule which perForms essential functions and are composed of heterodimer of α and β tubulin. The genes encoding microtubule are part of the tubulin superfamily. It plays a crucial role in the motility of flagella. It is a testis specific protein and hence facilitates the sperm morphology and motility. TUBA2 gene is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome.
Immunogen:
The immunogen for anti-TUBA3C antibody: synthetic peptide derected towards the N terminal of human TUBA3C
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/44/4/465

Related Post