Anti-USP48 (AB1) antibody produced in rabbit

Product Name: Anti-USP48 (AB1) antibody produced in rabbit

Synonym: Anti-DKFZp762M1713; Anti-MGC132556; Anti-MGC14879; Anti-RAP1GA1; Anti-USP31; Anti-Ubiquitin specific peptidase 48

Product Type: Chemical

CAS NO: 522-51-0Smad_Compound_Library inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 70 kDa
NCBI accession no.
NP_115612
Shipped in: wet ice
species reactivity
bovine, horse, rabbit, canine, zebrafish, rat, guinea pig, mouse, human
Storage temp.: −20°C
Application: Anti-USP48 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions:
Ubiquitin specific peptidase 48 (USP48; USP31) is a deubiquitinating enzyme that belongs to C19 peptidase family. It recognizes and hydrolyzes the peptide bond of ubiquitin at the C-terminal glycine. USP48 reportedly interacts with p65/RelA subunits of NF-κB and regulates its activation.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-USP48 antibody: synthetic peptide derected towards the C terminal of human USP48
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/353/1/80