Product Name: Anti-VDAC3 antibody produced in rabbit

Synonym: Anti-HD-VDAC3; Anti-Voltage-dependent anion channel 3

Product Type: Chemical

CAS NO: 23599-69-1DNA Alkylator_Crosslinker inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 31 kDa
NCBI accession no.
NP_001129166
species reactivity
rabbit, zebrafish, pig, bovine, human, guinea pig, canine, mouse, rabbit, rat, horse
Storage temp.: −20°C
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: VDAC3 is a member of the VDAC family which facilitates the exchange of ions and molecules between mitochondria and cytosol and is regulated by the interactions with other proteins and small molecules.
Immunogen:
The immunogen for anti-VDAC3 antibody: synthetic peptide derected towards the N terminal of human VDAC3
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF
RIDADR: NONH for all modes of transport
WGK Germany: 2
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/336/1/242

Related Post