Anti-YWHAH antibody produced in rabbit

Product Name: Anti-YWHAH antibody produced in rabbit

Synonym: Anti-Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; Anti-YWHA1

Product Type: Chemical

CAS NO: 1488363-78-5Casein Kinase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 28 kDa
NCBI accession no.
NP_003396
Shipped in: wet ice
species reactivity
zebrafish, canine, rabbit, human
Storage temp.: −20°C
Application: Anti-YWHAH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
YWHAH (14-3-3η) protein accumulates in meiotic spindles during mouse oocyte maturation. It is responsible for maintaining normal meiotic spindle Formation. It binds with the glucocorticoid receptor (GR) and has a regulatory role in GR-mediated cell signaling.
General description: YWHA or 14-3-3 proteins mediate several signaling pathways that are involved in cell cycle progression and growth.
Immunogen:
The immunogen for anti-YWHAH antibody: synthetic peptide derected towards the N terminal of human YWHAH
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/799