Product Name: Anti-YWHAQ antibody produced in rabbit

Synonym: Anti-1C5; Anti-HS1

Product Type: Chemical

CAS NO: 898800-26-5CRISPR_Cas9 inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 28 kDa
NCBI accession no.
NP_006817
Shipped in: wet ice
species reactivity
canine, zebrafish, bovine, guinea pig, rat, mouse, human
Storage temp.: −20°C
Application: Anti-YWHAQ antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
YWHAQ is a regulator of intrinsic apoptotic pathway. Promoter variation of YWHAQ gene reduces cell death and affects the treatment outcomes in childhood acute lymphoblastic leukemia.
Immunogen:
The immunogen for anti-YWHAQ antibody: synthetic peptide derected towards the N terminal of human YWHAQ
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/809

Related Post