Anti-YY1 (AB2) antibody produced in rabbit

Product Name: Anti-YY1 (AB2) antibody produced in rabbit

Synonym: Anti-YY1 transcription factor

Product Type: Chemical

CAS NO: 30578-37-1ATP Citrate Lyase inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_003394
Shipped in: wet ice
species reactivity
human, canine, mouse, bovine, zebrafish, rat
Storage temp.: −20°C
Application: Anti-YY1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
Yin Yang 1 (YY1) is a transcription factor with multiple functions in cell proliferation, differentiation, apoptosis and cell cycle progression. YY1 physically interacts with YAF2 protein; this interaction is essential for the recruitment of Polycomb group of proteins to the DNA. It also interacts with GATA3 to regulate Th2 cytokine locus and cell differentiation.
Immunogen:
The immunogen for anti-YY1 antibody: synthetic peptide derected towards the middle region of human YY1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/766