Product Name: Anti-ZDHHC13 antibody produced in rabbit

Synonym: Anti-FLJ10852; Anti-FLJ10941; Anti-HIP14L; Anti-HIP3RP; Anti-MGC64994; Anti-Zinc finger, DHHC-type containing 13

Product Type: Chemical

CAS NO: 58-85-5FLT3 inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 54 kDa
NCBI accession no.
NP_061901
Shipped in: wet ice
species reactivity
rabbit, horse, rat, zebrafish, guinea pig, bovine, human, mouse
Storage temp.: −20°C
Application: Anti-ZDHHC13 polyclonal antibody is used to tag zinc finger, DHHC-type containing 13 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of zinc finger, DHHC-type containing 13 in processes that involve Mg2+ transport and protein palmitoylation.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: Zinc finger, DHHC-type containing 13 (ZDHHC13, HIP14L, HIP3RP) is a Huntingtin-interacting protein that mediates the dual functions of palmitoyl acyltransferase and Mg2+ transport qualifying it as a chanzyme. Protein palmitoylation is important for the regulation of important cellular processes such as protein trafficking, stability, and protein-protein interactions. Improper palmitoylation may underlie diseases such as human alopecia, osteoporosis, and amyloidosis and many other neurodegenerative diseases caused by protein misfolding and amyloidosis.
Immunogen:
The immunogen for anti-ZDHHC13 antibody: synthetic peptide derected towards the N terminal of human ZDHHC13
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
Specificity:
Anti-ZDHHC13 polyclonal antibody reacts with chicken, human, mouse, rat, zebrafish, and bovine zinc finger, DHHC-type containing 13 proteins.
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/352/3/509

Related Post