Product Name: Anti-ZNF121 antibody produced in rabbit

Synonym: Anti-D19S204; Anti-ZHC32; Anti-ZNF20; Anti-Zinc finger protein 121

Product Type: Chemical

CAS NO: 442-52-4Dipeptidyl Peptidase inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 45 kDa
NCBI accession no.
NP_001008727
Shipped in: wet ice
species reactivity
rat, human, horse, mouse, rabbit
Storage temp.: −20°C
Application: Anti-ZNF121 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions:
ZNF121 is a transcription factor characterized by the presence of Krüppel-associated boxes or KRAB domain. Zinc finger proteins have diverse functions that include activation of transcription, regulation of apoptosis, protein folding, RNA packaging and lipid binding.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-ZNF121 antibody: synthetic peptide derected towards the middle region of human ZNF121
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: LTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/37/3/261

Related Post