Anti-ZNF174 antibody produced in rabbit

Product Name: Anti-ZNF174 antibody produced in rabbit

Synonym: Anti-Zinc finger protein 174

Product Type: Chemical

CAS NO: 1905481-36-8Dipeptidyl Peptidase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 46 kDa
NCBI accession no.
NP_003441
Shipped in: wet ice
species reactivity
rabbit, human, guinea pig
Storage temp.: −20°C
Application: Anti-ZNF174 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
ZNF174 is a transcription factor consisting of three zinc fingers and a finger-associated domain called the SCAN box. It represses the transcription of platelet-derived growth factor-B chain and transForming growth factor-β1 by binding to the respective promoters.
Immunogen:
The immunogen for anti-ZNF174 antibody: synthetic peptide derected towards the N terminal of human ZNF174
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFR
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/807