Product Name: Anti-ZNF318 antibody produced in rabbit

Synonym: Anti-Zinc finger protein 318

Product Type: Chemical

CAS NO: 1477949-42-0GlyT inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 232 kDa
NCBI accession no.
NP_055160
Shipped in: wet ice
species reactivity
rabbit, mouse, guinea pig, canine, horse, human
Storage temp.: −20°C
Application: Rabbit Anti-ZNF318 can be used for IHC (4-8μg/ml) and western blot (0.5μg/ml) applications.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: ZNF318 is a zinc-finger protein that is upregulated during respiratory syncytial virus (RSV) infection in pharyngeal cells.
Rabbit Anti-ZNF318 recognizes mouse, canine, and human ZNF318.
Immunogen:
The immunogen for anti-ZNF318 antibody: synthetic peptide derected towards the N terminal of human ZNF318
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/331/2/680

Related Post