Anti-ZNF341 (AB1) antibody produced in rabbit

Product Name: Anti-ZNF341 (AB1) antibody produced in rabbit

Synonym: Anti-Zinc finger protein 341

Product Type: Chemical

CAS NO: YAP inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 92 kDa
NCBI accession no.
NP_116208
Shipped in: wet ice
species reactivity
human, rabbit, mouse, canine, guinea pig, horse, bovine
Storage temp.: −20°C
Application: Anti-ZNF341 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
ZNF341 is a zinc finger-containing, 854 amino acid, nuclear protein that is involved in transcription regulation.
Immunogen:
The immunogen for anti-ZNF341 antibody: synthetic peptide derected towards the middle region of human ZNF341
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/429