Product Name: Anti-ZNF394 (AB1) antibody produced in rabbit

Synonym: Anti-Zinc finger protein 394

Product Type: Chemical

CAS NO: 1411977-95-1Infection inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 64 kDa
NCBI accession no.
NP_115540
Shipped in: wet ice
species reactivity
human, horse
Storage temp.: −20°C
Application: Rabbit Anti-ZNF394 (AB1) antibody can be used for immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) and western blot (0.25μg/ml) assays.
General description: ZNF394 is a zinc finger protein that can inhibit the transcriptional functions of c-JUN and AP-1. Hence, ZNF394 is known to function as a negative regulator of mitogen-activated protein kinase signaling. ZNF394 may also modulate heart functions. Rabbit Anti-ZNF394 (AB1) antibody binds to human ZNF394 (AB1).
Immunogen:
The immunogen for anti-ZNF394 antibody: synthetic peptide derected towards the N terminal of human ZNF394
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: GPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDPETSRLH
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/543

Related Post