Product Name: Anti-ZNF486 (AB1) antibody produced in rabbit

Synonym: Anti-KRBO2; Anti-MGC2396; Anti-Zinc finger protein 486

Product Type: Chemical

CAS NO: 72956-09-3GPR120 inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 54 kDa
NCBI accession no.
NP_443084
Shipped in: wet ice
species reactivity
zebrafish, rabbit, canine, bovine, human, mouse, rat, horse
Storage temp.: −20°C
Application: Anti-ZNF486 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
ZNF486 is a transcription factor characterized by the presence of Krüppel-associated boxes or KRAB domain. Zinc finger proteins have diverse functions that include activation of transcription, regulation of apoptosis, protein folding, RNA packaging and lipid binding.
Immunogen:
The immunogen for anti-ZNF486 antibody: synthetic peptide derected towards the middle region of human ZNF486
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: HKIIHTGEQPYKCKECDKAFNHPATLSSHKKIHTGEKPYTCDKCGKAFIS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/41/1/103

Related Post